PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013906913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 269aa    MW: 28301.8 Da    PI: 4.4763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013906913.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.6e-102261848
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     Ed  l   v+++G+ +W+ I++ +  gRt k c +rw++yl
   XP_013906913.1 22 EDVYLMASVEKYGTQRWSQISKGLS-GRTSKACSHRWRTYL 61
                     666677789****************.*************97 PP

2Myb_DNA-binding37.84.4e-1272114347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++ +E    v+a+k  G+  W+tIar+++ gRt   +k++w+ y
   XP_013906913.1  72 PFSDWEVAVVVEAHKHVGNQ-WSTIARMLP-GRTNAAVKNFWYAY 114
                      799***************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.2E-42063IPR001005SANT/Myb domain
PROSITE profilePS500909.0242161IPR017877Myb-like domain
SuperFamilySSF466896.94E-2221111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-152168IPR009057Homeodomain-like
PfamPF002498.1E-92161IPR001005SANT/Myb domain
CDDcd001672.57E-92161No hitNo description
PROSITE profilePS5129413.23865119IPR017930Myb domain
SMARTSM007171.5E-869117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1369119IPR009057Homeodomain-like
CDDcd001671.91E-772114No hitNo description
PfamPF002495.1E-972114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MYTTTTTTAI TTTLNDAQCV QEDVYLMASV EKYGTQRWSQ ISKGLSGRTS KACSHRWRTY  60
LQPGVKNTTQ EPFSDWEVAV VVEAHKHVGN QWSTIARMLP GRTNAAVKNF WYAYTRRSLK  120
GAPGGADDVD VGLGYHSAAS DGGGGGEWGP AAVLGARDDR NCSEGFGDEE DLGDEDLEDD  180
CDAEEEGEED AGCDEGGSLQ RHGLIAYDGA IDARHLLGSG QAWGAGESGI VPAALSDGPS  240
DGGIAGSSSS PRPPLRVKLG KGFKAAGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-242111933128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013906913.10.0Transforming protein Myb
TrEMBLA0A0D2LNP30.0A0A0D2LNP3_9CHLO; Transforming protein Myb
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-18myb domain protein 98
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]